2002 Volume 13 Issue 2

A Convenient and Efficient Procedure for Oxime Ethers
Chun Bao LI , Yi CUI , Wen Qin ZHANG , Jian Lin LI , Shuan Ming ZHANG , Michael C. K. CHOI , Albert S. C. CHAN
2002, 13(2): 95-96
[Abstract](794) [FullText HTML] [PDF 1267KB](9)
Abstract:
Acetophenone oxime and benzaldehyde oxime were converted to oxime ethers in the presence of alkyl halide or methyl sulfate and KOH in aqueous DMSO in 5 to 70 min.The yields of oxime ethers were 70-96%.
Catalytic HgCl2-Samarium System Induced Reductive Coupling of Nitriles with Nitro Compounds
Ji Ming ZHANG , Yong Min ZHANG
2002, 13(2): 97-100
[Abstract](732) [FullText HTML] [PDF 2488KB](0)
Abstract:
The intermolecular coupling of a nitro group with a cyano group mediated by a Sm(Hg) amalgam prepared from metal samarium powder and catalytic mercury dichloride was studied.
A Facile Construction of Eudesmanolide Denebutenolide via SmI2-catalyzed Rearrangement of an Enol Ester Epoxide
Wu Jiong XIA , De Run LI , Lei SHI , Ao Cheng CAO , Yong Qiang TU
2002, 13(2): 101-104
[Abstract](647) [FullText HTML] [PDF 2197KB](1)
Abstract:
A very convenient construction procedure of the α, β-unsaturated lactone has been carried out in 98% yield.SmI2 (10%) was used as catalyst for rearrangement of an enol ester epoxide of eudesmanolide sesquiterpene.The possible mechanism was also discussed.
A New Approach to α-Bromochalcones
Lei WANG , Zhi Zhen HUANG , Dong Xiang FENG
2002, 13(2): 105-106
[Abstract](752) [FullText HTML] [PDF 1077KB](4)
Abstract:
α-Bromo benzoylmethylene triphenylphosphorane 3 has been synthesized by the reaction of benzoylmethylene triphenylphosphorane 1 with N-bromosuccinimide in the yield of 87% and can react with aromatic aldehydes 4 to give α-bromochalcones 5 in good yields.
Hydrogenation of Cinnamaldehyde to Cinnamyl Alcohol over An Ultrafine Co-B Amorphous Catalyst
Xing Fan CHEN , He Xing LI , Ye Ping XU , Ming Hui WANG
2002, 13(2): 107-110
[Abstract](740) [FullText HTML] [PDF 3507KB](3)
Abstract:
A novel Co-B amorphous alloy catalyst in the form of ultrafine particles was prepared by chemical reduction of CoCl2 with aqueous NaBH4, which exhibited excellent activity and selectivity during the hydrogenation of cinnamaldehyde to cinnamyl alcohol in liquid phase.The optimum yield of cinnamyl alcohol was 87.6%, much better than the yield of using Raney Ni, Raney Co and other Co-based catalysts.
Synthesis of (2R, 4R)-2-N-tert-Butyloxycarbonyl Amino-4, 5-epoxido-valeric Acid Methyl Ester
Xin Rong QIN , Yu Li XIE , Qiao Ling ZHANG , Hui Bing LUO , Yu Yuan XIE
2002, 13(2): 111-112
[Abstract](781) [FullText HTML] [PDF 1380KB](1)
Abstract:
The stereoselective synthesis of (2R, 4R)-2-N-tert-butyloxycarbonyl amino-4, 5-epoxido-valeric acid methyl ester 8, which is the key intermediate for the synthesis of (2'S, 2R)-3-trans-nitrocyclopropyl-alanine, was first accomplished.
A Simple Synthesis of dl-Shikonin
Qun LU , Wen Hu DUAN , Jun Chao CAI
2002, 13(2): 113-114
[Abstract](718) [FullText HTML] [PDF 1323KB](0)
Abstract:
A new facile route for the synthesis of dl-shikonin is presented.Reformatsky reaction assisted cross-coupling of 1, 4, 5, 8-tetramethoxynaphthalene-2-carbaldehyde and ethyl-bromoacetate was employed for introduction of the side chain of dl-shikonin.
Synthesis of a New Chiral Ligand Containing 1, 5-Diazacyclooctane and the Application in Diethyl Zinc Addition to Benzaldehyde
Zhi Liang SHANG , Zhi Cai SHANG , Cheng Yun WANG , Qing Sen YU
2002, 13(2): 115-116
[Abstract](749) [FullText HTML] [PDF 1407KB](4)
Abstract:
A new chiral tetradentate ligand (S, S)-1, 5-bis (4-benzyloxazolin-2-yl-methyl)-1, 5-diazacyclo-octane 1 has been synthesized and the application of 1 as catalyst in the enantioselective addition of diethyl zinc to benzaldehyde is also described.
Efficient Synthesis of 3-N-Phthaloyl Homophenylalanine Lactone
Hao SHEN , An Pai LI , Hui WANG , Tong Xing WU , Xin Fu PAN
2002, 13(2): 117-118
[Abstract](742) [FullText HTML] [PDF 1331KB](0)
Abstract:
A new method for the synthesis of 3-N-phthaloyl homophenylalanine lactone has been developed and its mechanism was proposed
Synthesis of Cholest-5-en-24-oxo-3β, 19-Diacetate
Wei Gang LU , Ming Yan WANG , Jing Yu SU , Long Mei ZENG
2002, 13(2): 119-120
[Abstract](759) [FullText HTML] [PDF 1130KB](2)
Abstract:
Cholest-5-en-24-oxo-3β, 19-diacetate was synthesized starting from stigmasterol 3 via seven step reactions in 21.0% overall yield.It can be served as a key intermediate for the synthesis of many biologically active 19-hydroxylated sterols.
Synthesis of Alkoxysilanes Bearing β-Diketone Group through Hydrosilylation
Yuan YAO , Wei HUANG , Ying HUANG , Yun Zhao YU
2002, 13(2): 121-122
[Abstract](769) [FullText HTML] [PDF 1190KB](4)
Abstract:
Alkoxysilane bearing diketone group was synthesized by hydrosilylation of 3-allyl acetylacetone.It was indicated by the 1H NMR spectrum that the C=O group does not interfere with the synthesis.
A Novel Synthesis of Polyaniline Doped with Heteropolyacid and its Special Property
Jian GONG , Xiu Jun CUI , Shou Guo WANG , Zhong Wei XIE , Lun Yu QU
2002, 13(2): 123-124
[Abstract](725) [FullText HTML] [PDF 1084KB](1)
Abstract:
Polyaniline doped with heteropolyacid was synthesized using solid-state synthesis method.XRD pattern showed that polyaniline molecule has highly ordered arrangement.Fluorescence property of the polyaniline materials was found.
A Novel Fused Phosphorus Heterocycle:4-(1', 2', 3', 4'-Tetrahydro-1, 3, 2-benzodiazaphosphorin-2'-sulfide)-3, 4b, 4a-thiazphosphaphenanthridine Derivative
Jun Min HUANG , Hui CHEN , Ru Yu CHEN
2002, 13(2): 125-128
[Abstract](727) [FullText HTML] [PDF 2453KB](3)
Abstract:
The first example of fused phosphorus heterocyclic 4-[l'-(β-bromoethyl)-4'-oxo-3'-prop yl-1', 2', 3', 4-tetrahydro-1, 3, 2-benzodiazaphosphorin-2'-sulfide]-1, 2, 3, 4, 4a, 4b, 5, 6-octahydro-6-oxo-5-propyl-3, 4b, 4a-thiazphosphaphenanthridine 4a, 2'-dioxide was synthesized in excellent yield by refluxing a mixture of 1-(2-bromoethyt)-2, 3-dihydro-3-propyl-l, 3, 2-benzodiazaphos phorin-4(1H)-one 2-oxide with carbon disulfide in benzene in the presence of triethylamine.
Synthesis and Biological Activities of 3-(2-Furyl)-4-aryl-1, 2, 4-triazole-5-thiones
Xin Zhi LI , Zong Xing SI
2002, 13(2): 129-132
[Abstract](754) [FullText HTML] [PDF 2586KB](4)
Abstract:
A series of novel compounds 3-(2-furyl)-4-aryl-l, 2, 4-triazole-5-thiones have been synthesized.All the compounds were characterized by spectral data and elemental analysis.The preliminary biological test showed that some of them exhibited excellent plant-growth regulative acl ivities.
First Total Synthesis of an Analogue of (±)-Hypargenin B
An Pai LI , Hui WANG , Cheng Lu ZHANG , Tong Xing WU , Xin Fu PAN
2002, 13(2): 133-134
[Abstract](780) [FullText HTML] [PDF 1447KB](8)
Abstract:
First total synthesis of (±)-hypargenin B methyl ether 2 was accomplished via a strategy of AC→ABC, in which CrO3/H2O/NaOAc/HOAc system was utilized for introducing 7-keto group in order to avoid dehydration of benzyl tertiary alcohol.
Entry into Major Groups Retaining Taxol via Sinenxan A
Meng ZHANG , Da Li YIN , Ji Yu GUO , Xiao Tian LIANG
2002, 13(2): 135-138
[Abstract](736) [FullText HTML] [PDF 2522KB](1)
Abstract:
Compound 1 as a key intermediate of 1, 7, 9-trideoxytaxol was synthesized in ten steps from a biosynthetically available taxane, Sinenxan A.The key steps in the synthesis were deoxygenation at C-14, allylic oxidation at C-13 and construction of the oxetane ring.
A New Eremophilanoid Sesquiterpene from Senecio oldhamianus
Hua YANG , Qi Xiu ZHU , Zhong Jian JIA
2002, 13(2): 139-140
[Abstract](692) [FullText HTML] [PDF 1137KB](2)
Abstract:
A new Eremophilanoid sesquiterpene (1) was isolated from the whole plant of Senecio oldhamianus.Its structure was elucidated as 7β, 11-epoxy-9α, 10α-epoxy-8-oxoeremophilane using spectroscopic methords and X-ray analysis.
A New Abietane Diterpenoid from Orthosiphon wulfenioides
Wei XIANG , Sheng Hong LI , Qin Shi ZHAO , Zhi NA , Bei JIANG , Hong Jie ZHANG , Zhong Wen LIN , Han Dong SUN
2002, 13(2): 141-142
[Abstract](708) [FullText HTML] [PDF 1272KB](1)
Abstract:
A new abietane diterpenoid, orthosiphonol (11-methoxy-12, 14-dihydroxy-8, 11, 13-abieta trien-7-one) (1) together with known 11-hydroxysugiol (2) were isolated from Orthosiphon wulfenioides.Their structures were determined on the basis of spectroscopic evidence.
Two New Components from Serratula strangulata Iljin
Jing Qiu DAI , Yan Ping SHI , Li YANG , Yu LI
2002, 13(2): 143-146
[Abstract](737) [FullText HTML] [PDF 2450KB](2)
Abstract:
From the alcoholic extract of the whole plants of Serratula strangulata, two new compounds, named strangusin-A (1) and strangusin-B (2) have been isolated and their structures were established by spectroscopic method.
A Novel Polypeptide from Cervus elaphus Linnaeus
Liang WENG , Qiu Li ZHOU , Takashi IKEJIMA , Ben Xiang WANG
2002, 13(2): 147-150
[Abstract](738) [FullText HTML] [PDF 2391KB](0)
Abstract:
A novel polypeptide having stimulant effect on some cell proliferation was isolated from the velvet antler (Cervus elaphus Linnaeus).The velvet antler polypeptide consists of a single chain of 32 amino acid residues.Amino acid sequence of the polypeptide was identified as:VLSAADKSNVKAAWGKVGGNAPAFGAEALLRM.
Enantioseparation of Racemic Naproxen Esters on Cellulose Tris (4-methylbenzoate) Chiral Stationary Phase
Bao Hai SHAO , Xiu Zhu XU , Li ZOU , Xiao Yun FU
2002, 13(2): 151-152
[Abstract](790) [FullText HTML] [PDF 1544KB](0)
Abstract:
Several kinds of racemic naproxen ester were successfully separated on CTMB chiral stationary phase with hexane-ethanol (98:2, vol./vol.) as the mobile phase.The influence of mobile phase composition and structure of racemic naproxen ester on chiral separation was studied and the chiral recognition mechanism of CTMB was discussed.
Cyclic Voltammetry Determination of Epinephrine with a Nano-gold Modified Glassy Carbon Electrode in the Presence of High Concentration Ascorbic Acid
Hong ZHANG , Xue Qin GUI , Yang XU , Bao Kang JIN
2002, 13(2): 153-156
[Abstract](751) [FullText HTML] [PDF 2787KB](0)
Abstract:
Nano-gold (NG) modified glassy carbon electrodes (GCEs) were used for determination of epinephrine (EP) in the presence of high concentration ascorbic acid (AA) by cyclic voltammetry (CV).This modified electrode can not only catalytically oxidize EP and AA, but also separate the catalytic peak potentials of EP and AA by about 183.5 mV.In pH=7.0 ogisogate byffer solution, the linear range of epinephrine was 5×106~1×10-4 mol/L.
Enantiomeric Resolution on L-Carnitine Selective Polymers Prepared by Molecular Imprinting
Xiao Tao LI , Guang Guang JIANG , Yue Hua SHI , Zhu De XU
2002, 13(2): 157-158
[Abstract](734) [FullText HTML] [PDF 1480KB](1)
Abstract:
L-carnitine selective polymers were prepared by molecular imprinting using methacrylic acid as the functional monomer.The acid function of the monomer is expected to form hydrogen bond and ionic interactions with the amine function of the target molecule L-carnitine.The imprinted polymers were used as stationary phases in high-performance liquid chromatography (HPLC).It was shown that L-carnitine imprinted polymer exhibited a higher affinity to its template molecule, while the non-imprinted polymer had no affinity to the compounds tested.Racemic carnitine hydrochloride was efficiently resolved on the L-carnitine imprinted polymer, and the separation factor is 1.9.
Preparation of Nanoelectrode Ensembles by Assembly of Nano-Silver Colloid on Gold Surface
Gang XIA , Xiao Ya HU , Cheng Yin WANG , Gen Di JIN , Rong GUO
2002, 13(2): 159-162
[Abstract](750) [FullText HTML] [PDF 3159KB](0)
Abstract:
A novel method for preparing silver nanoelectrode ensembles (SNEEs) and gold nanoelectrode ensembles (GNEEs) has been developed.Silver colloid particles were first absorbed to the gold electrode surface to form a monolayer silver colloid.N-hexadecyl mercaptan was then assembled on the electrode to form a thiol monolayer on which hydrophilic ions cannot be transfered.The SNEEs was prepared by removing thiol from silver colloid surface through applying an AC voltage with increasing frequency at 0.20 V (vs.SCE).Finally, GNEEs was obtained by immersing a SNEEs into 6 mol/L HNO3 to remove the silver colloid particles.By comparison with other methods such as template method etc., this method enjoys some advantages of lower resistance, same diameter, easy preparation, controllable size and density.
Micro-patterning of Copper Based on Photolithographed Self-assembly Monolayers
Lan HUANG , Li Na XU , Hao Ying SHEN , Hai Qian ZHANG , Ning GU
2002, 13(2): 163-164
[Abstract](736) [FullText HTML] [PDF 1406KB](1)
Abstract:
A new method has been developed for fabrication of copper micro-pattern by selective chemical copper deposition based on photolithographed (3-mercaptopropyl)-trimethoxysilane (MPTS) self-assembly monolayers (SAMs).As confirmed by scanning electron microscopy (SEM), Cu closely replicated the mask features.The present approach makes this technic to be cheap and may be applicable to assembly of microelectronic circuits.
Real-time Analysis of the Interaction between Calmodulin and Melittin by SPR Spectroscopy
Wei Guo LI , Xiao Qiang CUI , Xiu Rong YANG , Da Qing ZHAO , Jia Zuan NI
2002, 13(2): 165-166
[Abstract](750) [FullText HTML] [PDF 1423KB](0)
Abstract:
The dynamic interaction process of calmodulin with an immobilized peptide melittin was investigated in real time by surface plasmon resonance spectroscopy, and dissociation constant of the complex was calculated to be 3.37×10-6mol/L.
The Synthesis and Absorption Character of New Bis (dithiobenzil) nickel Complex NIR Dyes
Ping Yan BIE , Hui WANG , Cheng Lu ZHANG , Xin Fu PAN , Teng Kuei YANG
2002, 13(2): 167-180
[Abstract](778) [FullText HTML] [PDF 2655KB](2)
Abstract:
A series of new NIR dyes bearing 4-(4-morpholinyl) phenyl and substituted phenyl, were synthesized.The maximum absorption wavelengths of these dyes range from 928 nm to 990 nm.
Aggregating Properties of Compounds Cz-C-n in DMSO-H2O Binary Solvent
Jiu Yan LI , Li Zhu WU , Li Ping ZHANG , Bo Jie WANG , Chen Ho TUNG
2002, 13(2): 171-174
[Abstract](766) [FullText HTML] [PDF 2362KB](0)
Abstract:
The aggregating properties of Cz-C-n (n=3, 6, 10) have been investigated by means of fluorescence method in DMSO-H2O binary solvent.The measured CAC and C Φ values indicate that the aggregating tendency of the amphiphilic compounds Cz-C-n containing crown ether increases with the length of alkyl chains, similar to that of carbazole compounds with long alkyl chains.
Effect of La2O3/γ-Al2O3 Catalyst on the Activation of CH4 and CO2 to C2 Hydrocarbons under Non-equilibrium Plasma
Xiu Ling ZHANG , Wei Min GONG , Bin DAI , Chang Hou LIU
2002, 13(2): 175-176
[Abstract](726) [FullText HTML] [PDF 1543KB](2)
Abstract:
In the reaction of methane and carbon dioxide to C2 hydrocarbons under non-equilibrium plasma, methane conversion was decreased, but selectivity of C2 hydrocarbons was increased when using La2O3/γ-Al2O3 as catalyst.So the yield of C2 hydrocarbons was higher than using plasma alone.The synergism of La2O3/γ-Al2O3 and plasma gave methane conversion of 24.9% and C2 yield of 18.1%.The distribution of C2 hydrocarbons changed when Pd-La2O3/γ-Al2O3 was used as catalyst, the major C2 product was ethylene.
Effect of Ni Loading on the Catalytic Properties of Molybdenum Oxides for the Isomerization of Heptane
Ying Jun WANG , Xin Ping WANG , Tian Xi CAI
2002, 13(2): 177-180
[Abstract](755) [FullText HTML] [PDF 2614KB](0)
Abstract:
The catalytic properties of MoOx and incorporation Ni onto the MoOx for the isomerization of heptane have been investigated under atmospheric pressure at different conditions such as different flow rate of H2, different reaction temperature etc..Compared with MoOx, the Ni addition to the MoOx markedly improved the isomerization activity of heptane by improving the reducibility of MoO3 and activation of H2 in reaction.
Fabrication of Ordered Macroporous CdS and ZnS by Colloidal Crystal Template
Ling Yun HAO , Min YOU , Xiao MO , Wan Quan JIANG , Yong ZHOU , Yu Rui ZHU , Yuan HU , Xian Ming LIU , Zu Yao CHEN
2002, 13(2): 181-182
[Abstract](710) [FullText HTML] [PDF 1539KB](0)
Abstract:
Ordered macroporous semiconductors CdS and ZnS with regular arrays of spherical pores have been fabricated by poly (styrene-acrylic) (PSA) colloidal crystal template.It was found that the exact three-dimensional (3D) structure of the template had been imprinted in the final material.
Preparation of Zeolite-metal Composite Membrane
Jie LIU , Xiao Bo CHEN , Wei Shen YANG , Ai Sheng HUANG , Li Wu LIN
2002, 13(2): 183-184
[Abstract](713) [FullText HTML] [PDF 1370KB](1)
Abstract:
A NaA zeolite membrane was synthesized on the surface of the stainless steel slab.The membrane was characterized by XRD and SEM.The membrane was continuous and highly intergrown.The size of NaA zeolite crystals was about 5~6 mm.
Synthesis and Structure of Mixed Distannoxane Dimers [ClR2SnOSnR'2Cl]2
Yan LÜ , Lin Hong WENG , Zhi Li LAN , Jing LI , Qing Lan XIE
2002, 13(2): 185-188
[Abstract](715) [FullText HTML] [PDF 2697KB](1)
Abstract:
Mixed distannoxane dimers [ClR2SnOSnR'2Cl]2 were synthesized by the reaction of R2SnO (R=Bu, Pr) and R2SnCl2 (R=Me, Ph, Cy, Oct).The crystal structures of compound 1 and 5 show they are ladder-type dimers that contain a central planar Sn2O2 four-membered ring.Both endo-and exo-Sn atoms are five-coordinate.
Address:Zhongguancun North First Street 2,100190 Beijing, PR China Tel: +86-010-82449177-888
Powered By info@rhhz.net