Citation:
Liang WENG, Qiu Li ZHOU, Takashi IKEJIMA, Ben Xiang WANG. A Novel Polypeptide from Cervus elaphus Linnaeus[J]. Chinese Chemical Letters,
;2002, 13(2): 147-150.
-
A novel polypeptide having stimulant effect on some cell proliferation was isolated from the velvet antler (Cervus elaphus Linnaeus).The velvet antler polypeptide consists of a single chain of 32 amino acid residues.Amino acid sequence of the polypeptide was identified as:VLSAADKSNVKAAWGKVGGNAPAFGAEALLRM.
-
Keywords:
- Velvet antler,
- peptide,
- amino acid sequence
-
-
-
-
[1]
Shaofeng Gong , Zi-Wei Deng , Chao Wu , Wei-Min He . Stabilized carbon radical-mediated three-component functionalization of amino acid/peptide derivatives. Chinese Chemical Letters, 2025, 36(5): 110936-. doi: 10.1016/j.cclet.2025.110936
-
[2]
Weiyu Chen , Zenghui Li , Chenguang Zhao , Lisha Zha , Junfeng Shi , Dan Yuan . Enzyme-modulate conformational changes in amphiphile peptide for selectively cell delivery. Chinese Chemical Letters, 2024, 35(12): 109628-. doi: 10.1016/j.cclet.2024.109628
-
[3]
Xiaofang Luo , Ye Wu , Xiaokun Zhang , Min Tang , Feiye Ju , Zuodong Qin , Gregory J Duns , Wei-Dong Zhang , Jiang-Jiang Qin , Xin Luan . Peptide-based strategies for overcoming multidrug-resistance in cancer therapy. Chinese Chemical Letters, 2025, 36(1): 109724-. doi: 10.1016/j.cclet.2024.109724
-
[4]
Juan Tao , Jinlong Yang , Mengyu Zhao , Quangang Zhu , Zhongjian Chen , Jianping Qi . Emerging trends in permeation-enhancing technologies for oral peptide delivery. Chinese Chemical Letters, 2026, 37(3): 111170-. doi: 10.1016/j.cclet.2025.111170
-
[5]
Rui Wang , He Qi , Haijiao Zheng , Qiong Jia . Light/pH dual-responsive magnetic metal-organic frameworks composites for phosphorylated peptide enrichment. Chinese Chemical Letters, 2024, 35(7): 109215-. doi: 10.1016/j.cclet.2023.109215
-
[6]
Cheng-Yan Wu , Yi-Nan Gao , Zi-Han Zhang , Rui Liu , Quan Tang , Zhong-Lin Lu . Enhancing self-assembly efficiency of macrocyclic compound into nanotubes by introducing double peptide linkages. Chinese Chemical Letters, 2024, 35(11): 109649-. doi: 10.1016/j.cclet.2024.109649
-
[7]
Mengmeng Yuan , Xiwen Hu , Na Li , Limin Xu , Mengxi Zhu , Xing Pei , Rui Li , Lu Sun , Yupeng Chen , Fei Yu , Huining He . Kidney targeted delivery of siRNA mediated by peptide-siRNA conjugate for the treatment of acute kidney injury. Chinese Chemical Letters, 2025, 36(6): 110251-. doi: 10.1016/j.cclet.2024.110251
-
[8]
Min Fu , Ruihan Wang , Wenqiang Liu , Sen Zhou , Chunhong Zhong , Yaohao Li , Pan He , Xin Li , Shiying Shang , Zhongping Tan . Improved one-pot protein synthesis enabled by a more precise assessment of peptide arylthioester reactivity. Chinese Chemical Letters, 2025, 36(7): 110542-. doi: 10.1016/j.cclet.2024.110542
-
[9]
Weiqi Zhang , Hang Wu , Limin Xie , Yixin Liang , Xiaowan Huang , Zhimou Yang , Tengyan Xu , Feng Lin . A two-component peptide-based hydrogel for endometrial repair and restoring fertility. Chinese Chemical Letters, 2025, 36(10): 110800-. doi: 10.1016/j.cclet.2024.110800
-
[10]
Ying Sun , Minglong Chen , Ying Chen , Wanchen Zhao , Yanping Fu , Zhengwei Huang , Chao Lu , Chuanbin Wu , Xin Pan , Guilan Quan . Dissolving microneedle-assisted in situ cancer vaccine combined with cytolytic peptide for anti-melanoma immunotherapy. Chinese Chemical Letters, 2025, 36(12): 110908-. doi: 10.1016/j.cclet.2025.110908
-
[11]
Tianheng Chen , Yanyu Zhang , Zhen Fang , Anze Liu , Yingxin Dong , Xiying Wu , Feng Yang , Huan Wang . Diphtheria toxin-derived short peptide enables dual targeted delivery of vorinostat for glioma treatment. Chinese Chemical Letters, 2026, 37(3): 111254-. doi: 10.1016/j.cclet.2025.111254
-
[12]
Qiang Luo , Jinfeng Sun , Zhibo Li , Bin Liu , Jianxun Ding . Thermo-sensitive poly(amino acid) hydrogel mediates cytoprotection through an antioxidant mechanism. Chinese Chemical Letters, 2025, 36(7): 110433-. doi: 10.1016/j.cclet.2024.110433
-
[13]
Qi Wei , Hua Xin , Xiaolong Wang , Changjuan Qin , Yuanzhen Su , Di Li , Jianxun Ding . Unimolecular chiral poly(amino acid)s as adjuvants of nanovaccines for augmented cancer immunotherapy. Chinese Chemical Letters, 2025, 36(11): 111477-. doi: 10.1016/j.cclet.2025.111477
-
[14]
Jianhui Yin , Wenjing Huang , Changyong Guo , Chao Liu , Fei Gao , Honggang Hu . Tryptophan-specific peptide modification through metal-free photoinduced N-H alkylation employing N-aryl glycines. Chinese Chemical Letters, 2024, 35(6): 109244-. doi: 10.1016/j.cclet.2023.109244
-
[15]
Chuanfeng Fan , Jian Gao , Yingkai Gao , Xintong Yang , Gaoning Li , Xiaochun Wang , Fei Li , Jin Zhou , Haifeng Yu , Yi Huang , Jin Chen , Yingying Shan , Li Chen . A non-peptide-based chymotrypsin-targeted long-wavelength emission fluorescent probe with large Stokes shift and its application in bioimaging. Chinese Chemical Letters, 2024, 35(10): 109838-. doi: 10.1016/j.cclet.2024.109838
-
[16]
Tianxu Zhang , Dexuan Xiao , Mi Zhou , Yunfeng Lin , Tao Zhang , Xiaoxiao Cai . Protective effect of osteogenic growth peptide functionalized tetrahedral DNA nanostructure on bone marrow and bone formation ability in chemotherapy-induced myelosuppressive mice. Chinese Chemical Letters, 2025, 36(8): 110594-. doi: 10.1016/j.cclet.2024.110594
-
[17]
Xianghua Zeng , Weichen Meng , Xiaochun Han , Jiachen Yang , Kaiqi Wu , Fengxian Gao , Xiliang Luo . Highly stable and antifouling solid-contact ion-selective electrode for K+ detection in complex system based on multifunctional peptide and conductive MOF. Chinese Chemical Letters, 2025, 36(8): 110564-. doi: 10.1016/j.cclet.2024.110564
-
[18]
Yiyue Ding , Qiuxiang Zhang , Lei Zhang , Qilu Yao , Gang Feng , Zhang-Hui Lu . Exceptional activity of amino-modified rGO-immobilized PdAu nanoclusters for visible light-promoted dehydrogenation of formic acid. Chinese Chemical Letters, 2024, 35(7): 109593-. doi: 10.1016/j.cclet.2024.109593
-
[19]
Kuangdi Luo , Yang Qin , Xuehao Zhang , Hanxu Ji , Heao Zhang , Jiangtian Li , Xianjin Xiao , Xinyu Wang . Regulable toehold lock for the effective control of strand displacement reaction sequence and circuit leakage. Chinese Chemical Letters, 2024, 35(7): 109104-. doi: 10.1016/j.cclet.2023.109104
-
[20]
Long Yin , Yuxin Shi , Rong Meng , Jiapei Shan , Weiwei Sun , Weijun Yao , Xiaowei Dou , Dong Guo . Development and enantioselective synthesis of spirobiindoles via Rh-catalyzed asymmetric arylation-spirocyclization sequence. Chinese Chemical Letters, 2026, 37(3): 111258-. doi: 10.1016/j.cclet.2025.111258
-
[1]
Metrics
- PDF Downloads(5)
- Abstract views(1350)
- HTML views(24)
Login In
DownLoad: